PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28426.4 Da    PI: 9.6366
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004839.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.72.3e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++
  Aco004839.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYAT 59
                 79***********************************************86 PP

2K-box107.51.5e-35801746100
        K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                   +s++ + + ++++e++kLk+++e +q++qRhl+Ge+LesL+lkeLqqLeqqLe+slk+iRs+K++lll++i+el++kek+lqe+nkaL+k+l+e
  Aco004839.1  80 LVSADPESQGNWCHEYSKLKARVEAIQKSQRHLMGEQLESLNLKELQQLEQQLESSLKHIRSRKSQLLLDSISELKRKEKSLQEHNKALEKELME 174
                  5555666788*********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.997161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-34290IPR002100Transcription factor, MADS-box
CDDcd002655.98E-42276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.7E-3187172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.47288178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYATD  60
SSMEKILERY ERYSYAEKAL VSADPESQGN WCHEYSKLKA RVEAIQKSQR HLMGEQLESL  120
NLKELQQLEQ QLESSLKHIR SRKSQLLLDS ISELKRKEKS LQEHNKALEK ELMEKQKALT  180
QQQHWEQQTQ PPTNSSSPLS FLLPTDSLPT LNIGTYQATG TGAEEVEGIA QPQARMGLPP  240
WMVRHLNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q1e-22174173Myocyte-specific enhancer factor 2B
1tqe_R1e-22174173Myocyte-specific enhancer factor 2B
1tqe_S1e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008794203.11e-131PREDICTED: MADS-box transcription factor 14-like
SwissprotQ10CQ11e-113MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA9Q2791e-122A9Q279_9LILI; APETALA1-like protein
TrEMBLM0SRG51e-122M0SRG5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P23540_0011e-122(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.17e-74AGAMOUS-like 8